SNX-482 explained
SNX-482 is a toxin from the tarantula Hysterocrates gigas. It acts as a high-affinity blocker of R-type Ca2+ (Cav2.3) channels, but at higher concentrations it can also block other Ca2+ channels and Na+ channels.
Sources
SNX-482 is isolated from the venom of the spider Hysterocrates gigas.[1]
Sequence
GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD-OH[1]
Homology
SNX-482 is homologous to the spider peptides grammatoxin S1A and hanatoxin.[1]
Target
Cav2.3 (alpha1E, R-type) channel (strong affinity), L-type Ca2+ channel, P/Q type Ca2+ channel, Na+ channel.[1] [2] [3] "SNX-482 [also] dramatically reduced the A-type potassium current in acutely dissociated dopamine neurons from mouse substantia nigra pars compacta."[4]
Mode of action
The compound was initially identified as a selective, voltage-dependent inhibitor of Cav2.3 (a1E, R-type) channels.[1] SNX-482 inhibits native R-type Ca2+ currents at weak nanomolar concentrations in rat neurohypophyseal nerve terminals. However, it does not influence R-type Ca2+ currents at concentrations of 200–500 nM in several types of rat central neurons.[1] Washout could only moderately reverse the R-type Ca2+ channel inhibition after treatment with 200 nM SNX-482. However, application of strong voltage reverses the blocking of R-type Ca2+ channels.[2] SNX-482 needs to interact with a1E domains III and IV to play a role in the significant inhibition of R-type channel gating.[2] Although SNX-482 is generally viewed as a selective inhibitor of Cav2.3 (a1E, R-type) channels, more recently it was shown that it can also inhibit L-type or P/Q type Ca2+ channels and incompletely block Na+ channels.[1] [2] [3]
Research and therapeutic use
SNX-482 has been used to elucidate the roles of theaflavin-3-G in transmitter release.[5] Furthermore, some research has indicated that it inhibits neuronal responses in a neuropathic pain model, so it is possible that SNX-482 can be used to reduce dorsal horn neuronal pain in neuropathic pain therapy.[6]
Notes and References
- Newcomb . Robert . Szoke . Balazs . Palma . Andrew . Wang . Gang . Chen . Xiao-hua . Hopkins . William . Cong . Ruth . Miller . Jim . Urge . Laszlo . Tarczy-Hornoch . Katalin . Loo . Joseph A. . Dooley . David J. . Nadasdi . Laszlo . Tsien . Richard W. . Lemos . José . Miljanich . George . Selective Peptide Antagonist of the Class E Calcium Channel from the Venom of the Tarantula Hysterocrates gigas . Biochemistry . 37 . 44 . 1998-11-01 . 0006-2960 . 10.1021/bi981255g . 15353–15362 . 9799496 . 1.
- Bourinet . Emmanuel . Stotz . Stephanie C. . Spaetgens . Renée L. . Dayanithi . Govindan . Lemos . José . Nargeot . Joël . Zamponi . Gerald W. . Interaction of SNX482 with Domains III and IV Inhibits Activation Gating of α1E (CaV2.3) Calcium Channels . Biophysical Journal . Elsevier BV . 81 . 1 . 2001 . 0006-3495 . 10.1016/s0006-3495(01)75681-0 . 79–88 . 11423396 . 1301493 . 2001BpJ....81...79B . 1.
- Arroyo . G . SNX482 selectively blocks P/Q Ca2+ channels and delays the inactivation of Na+ channels of chromaffin cells . European Journal of Pharmacology . Elsevier BV . 475 . 1–3 . 2003-08-15 . 0014-2999 . 10.1016/s0014-2999(03)02084-3 . 11–18. 12954354 .
- Kimm . T. . Bean . B. P. . Inhibition of A-Type Potassium Current by the Peptide Toxin SNX-482 . Journal of Neuroscience . Society for Neuroscience . 34 . 28 . 2014-07-09 . 0270-6474 . 10.1523/jneurosci.0339-14.2014 . 9182–9189. 25009251. 4087201 .
- Wang . Gang . Dayanithi . Govindan . Newcomb . Robert . Lemos . José R. . An R-Type Ca2+Current in Neurohypophysial Terminals Preferentially Regulates Oxytocin Secretion . The Journal of Neuroscience . Society for Neuroscience . 19 . 21 . 1999-11-01 . 0270-6474 . 10.1523/jneurosci.19-21-09235.1999 . 9235–9241 . 10531427 . 6782897 . 1.
- Trevisan . Gabriela . Oliveira . Sara Marchesan . Animal Venom Peptides Cause Antinociceptive Effects by Voltage-gated Calcium Channels Activity Blockage . Current Neuropharmacology . Bentham Science Publishers Ltd. . 20 . 8 . 2022 . 1570-159X . 10.2174/1570159x19666210713121217 . 1579–1599. 34259147. 9881091 .